PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016446656.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 184aa    MW: 21196.8 Da    PI: 9.9483
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016446656.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.23.9e-171561147
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                    k+ie++  r+ tfskRr gi KKA+EL  LC++++ +++fs+tgk +
  XP_016446656.1 15 KKIESEDDRYATFSKRRSGIYKKASELVKLCNIDIGIVLFSPTGKPF 61
                    68******************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.4E-20766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.712767IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-22878IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-15929IPR002100Transcription factor, MADS-box
PfamPF003195.2E-211663IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-152944IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-154465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MEGKKTRGRQ SIPMKKIESE DDRYATFSKR RSGIYKKASE LVKLCNIDIG IVLFSPTGKP  60
FSFFHPTSEA IIDRFLNPNT QLSESTRLVA AHARNKVNQL NNRRELFDNI KEVTSAQSLL  120
LDNMKENGQR YRWESIEQFN ADEVKKYEAW LSTTVFNLNN RLKHLKNEAS SSSSSQAYPE  180
NTDN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009595132.11e-135PREDICTED: agamous-like MADS-box protein AGL61
RefseqXP_016446656.11e-135PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLM1DXG32e-66M1DXG3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000959807e-66(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38220138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.18e-28AGAMOUS-like 61